PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 343aa    MW: 38110.2 Da    PI: 6.5183
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783051.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.1e-10144200561
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                     kr++r   NR +A+rs +RK  +i eLe+kv++L++e ++L  +l   +    + ++
  XP_009783051.1 144 KRAKRILANRQSASRSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDTTQFTN 200
                     9*****************************************999877766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-16140204IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737142205IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.7E-8144190No hitNo description
PfamPF001701.0E-8144192IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-10144195No hitNo description
CDDcd147037.25E-22145194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MQDPSNPNSK NQTPSFSATF RPSHHRRAHS EVNFRLPEDL DLVSDPFDAS AGSFEEIGSE  60
DDFFSTYMDI EKLGTGSNPT DGFNNAAGSS SGLLVADGEK TFSRPRHRHS NSVDSSSLLL  120
SESIEAKKAM APDKLAELWT IDPKRAKRIL ANRQSASRSK ERKARYITEL ERKVQTLQTE  180
ATTLSAQLTL FQRDTTQFTN ENTELKIRLQ AMAQQAQLRD ALNEALKQEV ERLKMATGEM  240
SSSDAYNLGM QHIPYNQSAF FSHQTQSGPS ESQNIQMQQF HSLQDSLLTP HRRLLAGHGQ  300
ALPDTMQQDP LGRFQGLDIG GRGMHHVKTE TPSISASESS STL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-140HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783051.10.0PREDICTED: transcription factor RF2b-like
RefseqXP_016436686.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-104RF2B_ORYSJ; Transcription factor RF2b
TrEMBLK4C5B00.0K4C5B0_SOLLC; Uncharacterized protein
STRINGSolyc06g048630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34252349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.19e-95bZIP family protein